PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003375-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 167aa    MW: 18319.4 Da    PI: 5.8555
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003375-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB167.41.8e-5242138197
                  NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                            +req+r+lPianv+rimk++lP nakisk+aket+qec+sefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dy ++lk yl 
  SMil_00003375-RA_Salv  42 MREQERLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASDKCHKEKRKTVNGDDICWALGSLGFDDYGDSLKRYLV 129
                            58************************************************************************************** PP

                  NF-YB  89 kyrelegek 97 
                            +yre+ege+
  SMil_00003375-RA_Salv 130 RYREAEGER 138
                            ******997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-5038147IPR009072Histone-fold
SuperFamilySSF471139.83E-3845145IPR009072Histone-fold
PfamPF008081.4E-2748112IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.9E-177694No hitNo description
PROSITE patternPS0068507995IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.9E-1795113No hitNo description
PRINTSPR006152.9E-17114132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MVDNIGPNHS SRQRGLRSSY TSYAASVAAV SGGGGDEDEG GMREQERLLP IANVGRIMKQ  60
ILPPNAKISK EAKETMQECA SEFISFVTGE ASDKCHKEKR KTVNGDDICW ALGSLGFDDY  120
GDSLKRYLVR YREAEGERAA NQNKAPAAPD DGGLPFSFDL MEKRRIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4342133192Transcription factor HapC (Eurofung)
4g92_B1e-4342133192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703063e-69HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079712.11e-74PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822484e-57NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM5VPK98e-67M5VPK9_PRUPE; Uncharacterized protein
STRINGPOPTR_0014s12710.16e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.15e-58nuclear factor Y, subunit B5